Noradrenaline transporter (SLC6A2) Rabbit Polyclonal Antibody TA346265 from OriGene Technologies | Biocompare.com

Supplier Images

Noradrenaline transporter (SLC6A2) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Noradrenaline transporter (SLC6A2) Rabbit Polyclonal Antibody

OriGene Technologies' Noradrenaline transporter (SLC6A2) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Noradrenaline transporter (SLC6A2) Rabbit Polyclonal Antibody was generated using SLC6A2 as the antigen and it reacts with Human, and Rat.

Description

Rabbit Polyclonal Anti-SLC6A2 Antibody

Product Specs
ItemNoradrenaline transporter (SLC6A2) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA346265
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman, Rat
TargetSLC6A2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-SLC6A2 antibody: synthetic peptide directed towards the middle region of human SLC6A2. Synthetic peptide located within the following region: FTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGV
NCBI Full Gene Namesolute carrier family 6 member 2
NCBI Gene AliasesNAT1, NET, SLC6A5, NET1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!